본문 바로가기
paper

Sample protein sequence

by hongiiv 2007. 7. 30.
반응형
>gi|2501594|sp|Q57997|Y577_METJA PROTEIN MJ0577 MSVMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFE NELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLG SVTENVIKKSNKPVLVVKRKNS
반응형

댓글0