본문 바로가기

paper7

추가해두면 좋을 wsdl 목록 Taverna에 없는 유용한 WSDL들 http://phoebus.cs.man.ac.uk:1977/axis/services http://192.168.100.205:8080/JAX-WS20Project/runNCBIBlast?wsdl http://xml.nig.ac.jp/wsdl/Blast.wsdl http://phoebus.cs.man.ac.uk:8081/axis/EnsemblListner.jws?wsdl WorkFlow 파일들이 쌓인곳 http://www.cs.man.ac.uk/~fisherp/workflows.html example0-\n\n) import java.util.*; StringTokenizer = tk = new StringTokenizer(input,">"); int tkCount .. 2007. 8. 21.
Blast Result 비교 Blast Web Service를 제공하는 DDBJ, EBI와 내가 만든 Blast의 총 3개에 대하여 blastp, swissprot 데이터베이스, 서열(>gi|2501594|sp|Q57997|Y577_METJA PROTEIN MJ0577)에 대해서 Blast를 수행한 결과입니다. 결과는 당연히 똑같아야 하겠지만, Blast의 버전이 제가 2.2.14 버전으로 좀 낮고 swissprot데이터베이스는 DDBJ가 좀 틀리네요 ^^ 각각의 Blast 결과를 보시려면 more를 클릭하세요^^;; ========================================== ===========DDBJ BLAST with SWISS Prot=========== =============================.. 2007. 8. 8.
Sample protein sequence >gi|2501594|sp|Q57997|Y577_METJA PROTEIN MJ0577 MSVMYKKILYPTDFSETAEIALKHVKAFKTLKAEEVILLHVIDEREIKKRDIFSLLLGVAGLNKSVEEFE NELKNKLTEEAKNKMENIKKELEDVGFKVKDIIVVGIPHEEIVKIAEDEGVDIIIMGSHGKTNLKEILLG SVTENVIKKSNKPVLVVKRKNS 2007. 7. 30.
papers 할인 쿠폰 도착 I am a student could I get a discount?를 보면 학생임을 확인할 수 있는 학생증이나 기타등등을 보내면 40% 할인 쿠폰을 보내준다고 했다. 나도 엄연한 학생이기 때문에 학생증(물론 한글로 된)을 스캔해서 보냈더니 떡하니 할인 코드가 날아왔다. 얼렁 구매해야지.. 2007. 7. 18.